PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G025800.1.p
Common NameGLYMA_09G025800, LOC100794552
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 714aa    MW: 81359.9 Da    PI: 7.867
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G025800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-182981456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          ++++++q ++LeelF+k+++p++ er+++Ak lgL+ +qVk+WFqN+R+++k
  Glyma.09G025800.1.p 29 YRRHKEDQRTRLEELFRKCPNPDEIERRQIAKDLGLEPKQVKFWFQNKRTQKK 81
                         567899********************************************998 PP

2START126.53.2e-402314522206
                          HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                          +a +a +el+k+   +ep+Wvkss             e++ ++ +  +       ++e +++s++v   + +lv  ll++   W + +  
  Glyma.09G025800.1.p 231 IAVAAKDELLKLLRTNEPLWVKSStdqryvlH----LECYETIFPRINhfknskARVESSKDSRIVRIKAKELVDMLLNSE-IWENLFSr 315
                          688999******************65543321....3344433333335677777****************9**9999999.66666666 PP

                          ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
                START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                             ka t++v+++g      g+l lm  e+ +lsplvp R+f+f+Ry+ q +a +wvi+dvSvd  ++++ ++++ R   +pSg++i+  
  Glyma.09G025800.1.p 316 ivtKARTIQVLENGslenrsGVLLLMREEMHVLSPLVPsREFYFLRYCHQVEANVWVIADVSVDCMKENNHDPNCWR---FPSGCMIQGI 402
                          666*****************************************************************999999999...********** PP

                          CTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 158 snghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          sng ++v wvehv++++++  h l++ lv++ +a ga +w+  lqr ce+
  Glyma.09G025800.1.p 403 SNGMCQVSWVEHVEVDEKIQtHHLFKDLVNRNIAYGAERWLLELQRMCER 452
                          *******************99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-171165IPR009057Homeodomain-like
SuperFamilySSF466892.09E-161182IPR009057Homeodomain-like
PROSITE profilePS5007115.2082383IPR001356Homeobox domain
SMARTSM003892.9E-142587IPR001356Homeobox domain
PfamPF000463.7E-163081IPR001356Homeobox domain
CDDcd000864.05E-143081No hitNo description
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.608.1E-466111IPR009057Homeodomain-like
PROSITE profilePS5084843.716221455IPR002913START domain
SuperFamilySSF559612.47E-28222453No hitNo description
CDDcd088751.05E-89225451No hitNo description
SMARTSM002341.8E-25230452IPR002913START domain
PfamPF018521.1E-33231452IPR002913START domain
Gene3DG3DSA:3.30.530.209.3E-6288421IPR023393START-like domain
SuperFamilySSF559612.61E-10476704No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MDFAMGAAGG SGDDQHNQSL NKGKKTTTYR RHKEDQRTRL EELFRKCPNP DEIERRQIAK  60
DLGLEPKQVK FWFQNKRTQK KTISERVDNN VLRVENERMH NENLVLREAL KTIICPSCGG  120
PHNEEERREL CLEQLRLENA RLKAQHEKLS KFLVQHMDKP ILEQNLDSPI RGSSSHGPLL  180
GSSLRLRAGR SRMNLGASTS HDSFQDEEDT MSSQAGSKII TQMEKTMMAH IAVAAKDELL  240
KLLRTNEPLW VKSSTDQRYV LHLECYETIF PRINHFKNSK ARVESSKDSR IVRIKAKELV  300
DMLLNSEIWE NLFSRIVTKA RTIQVLENGS LENRSGVLLL MREEMHVLSP LVPSREFYFL  360
RYCHQVEANV WVIADVSVDC MKENNHDPNC WRFPSGCMIQ GISNGMCQVS WVEHVEVDEK  420
IQTHHLFKDL VNRNIAYGAE RWLLELQRMC ERFTSLEVEY IPNYDIGGVI TTLGGRMSMM  480
KFSHQMVKSF YGILNMSSIT DFPQHLADEN TGIRICARKV TNSNQSNPNI IITATTSFRL  540
PLPSQNVFDF FRDPIRRVKW DAMCYKRPLH EIARISTGTH PNNYISIIQP IHPTANNVVI  600
IQESCTDPLG SYVVYSSTNI LDIKRTINGE DSSTMPFFPS GIVISEEGQS ITNARASSSG  660
NGDVRTRGSL LTVAFQILMN SSPTMMMEFV TVVNSLITST VENINDALIS SFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586851.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2
TrEMBLI1L0G60.0I1L0G6_SOYBN; Uncharacterized protein
STRINGGLYMA09G02990.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-159homeodomain GLABROUS 11